PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_38472g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 748aa    MW: 82846.9 Da    PI: 7.0016
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_38472g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2074129156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++ +++t++q++e+e+lF++ ++p++++r++L+kklgL  rqVk+WFqNrR++ k
  MA_38472g0010  74 KKRYHRHTPQQIQEMEALFKEFPHPDEKQRQQLSKKLGLAPRQVKFWFQNRRTQLK 129
                    688999**********************************************9877 PP

2START173.81.1e-542674901206
                    HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                    ela++a++el+k  + eep+Wv+ +    e ++ +e+ ++f++  +      ++ea r + +v m + + v +l++ + +W et++    +a+t++
  MA_38472g0010 267 ELALAAMDELMKISQTEEPLWVRNPeggmETLDHEEYSREFPRLIGpkpigHKTEATRHTDIVVMKSSTIVDTLINAN-RWMETFPciisRATTVD 361
                    5899*********************999989999999999988888********************************.***************** PP

                    EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
          START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    vis+g      galqlm+aelq+lspl p R+ +fvR+++q+ +g w +vdvSvd   + p ++s+ +++++pSg+l+++++n++skvtwveh ++
  MA_38472g0010 362 VISNGvggtrnGALQLMYAELQVLSPLLPtREIYFVRFSKQHADGLWGVVDVSVDGLLDSP-DASLTKCRKRPSGCLLRDMPNNRSKVTWVEHLEY 456
                    *************************************************************.9********************************* PP

                    -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 173 kgrlphwllrslvksglaegaktwvatlqrqcek 206
                    +   +h ++rs+++sg+a+ga++wvatlqrqc++
  MA_38472g0010 457 DNVGVHRIFRSIISSGMAFGAQRWVATLQRQCQR 490
                    ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.75E-1957132IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-2158125IPR009057Homeodomain-like
PROSITE profilePS5007117.28171131IPR001356Homeobox domain
SMARTSM003894.7E-1972135IPR001356Homeobox domain
CDDcd000861.97E-1874132No hitNo description
PfamPF000466.7E-1874129IPR001356Homeobox domain
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PROSITE profilePS5084840.187258493IPR002913START domain
SuperFamilySSF559611.28E-28261490No hitNo description
CDDcd088755.38E-113262489No hitNo description
PfamPF018521.2E-45267490IPR002913START domain
SMARTSM002342.9E-48267490IPR002913START domain
SuperFamilySSF559614.12E-20517740No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MPCAPTMAHA RVTASAIKSR NPFFSSTGLS LMLPGVGGEG QNRSGHDEDQ DYESSENMEG  60
GSGDDIADLD HPRKKRYHRH TPQQIQEMEA LFKEFPHPDE KQRQQLSKKL GLAPRQVKFW  120
FQNRRTQLKA TQERHENSLL RQEIEQLRSE NASLRESLRN PICSICGGRG LNGDLMSFDE  180
QQLRHENARL KDELDRVCVL VEKLSGRPNS CVLVEKLSGR PNSSIIPASN SSLDLTVGLS  240
GLHSAALNSI NQRSMVLMGI ERSKVTELAL AAMDELMKIS QTEEPLWVRN PEGGMETLDH  300
EEYSREFPRL IGPKPIGHKT EATRHTDIVV MKSSTIVDTL INANRWMETF PCIISRATTV  360
DVISNGVGGT RNGALQLMYA ELQVLSPLLP TREIYFVRFS KQHADGLWGV VDVSVDGLLD  420
SPDASLTKCR KRPSGCLLRD MPNNRSKVTW VEHLEYDNVG VHRIFRSIIS SGMAFGAQRW  480
VATLQRQCQR VAFLMSTNAP TGDLAAVPTP SGRRSLMKLA ERMTNKFCSG VSASSRHTWT  540
KLSQGSGDDD VRVMSRKNVD DPGEPPGVVL SAATSLWLPV SPNRLFDFLR DQRFRSEWDI  600
LSNGSPIEEV THISNGKDRG NRVSVLSAKN SNQSNTLILQ ESCADSYGSM VVYAPVEISA  660
IHQVMNGNDS INVALLPSGF VILPEGPPES RSLVDNQPVE GSLLTIAFQI LVNDLPTAKL  720
TLESVETVNN LISCTAQRIK AALQKEDV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1026000.0BT102600.1 Picea glauca clone GQ0197_K07 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083470.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0D6QVJ60.0A0A0D6QVJ6_ARACU; Uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein